Search for sequences, models, functions, methods, and more
| Origin | UNIPROT |
|---|---|
| Type | UID Search |
| Query | Q29963 |
Sequence |
MRVMAPRTLILLLSGALALTETWACSHSMRYFDTAVSRPGRGEPR |
Results |
Please wait while we prepare your results |
Search for sequences, models, functions, methods, and more
| Origin | UNIPROT |
|---|---|
| Type | UID Search |
| Query | Q29963 |
Sequence |
MRVMAPRTLILLLSGALALTETWACSHSMRYFDTAVSRPGRGEPR |
Results |
Please wait while we prepare your results |
Explore proteins and this website
